Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lf6A_

Fold library idPDB HeaderMoleculeTitle
c6lf6A_2.04PDB header: transferaseChain: A: PDB Molecule: udp-glycosyltransferase 708a6;


Added to library: Sat Nov 21 08:54:09 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARPHVVLLPSAGMGHLVPFARLAVALSEGHGCNVSVAAVQPTVSSAESRLLDALFVAAAPAVRRLDFRLA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




SS


SS
SSTTTT



 .........80.........90.........100.........110.........120.........130.........140
Sequence PFDESEFPGADPFFLRFEATRRSAPLLGPLLDAAEASALVTDIVLASVALPVARERGVPCYVLFTSSAAM
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


GGGSTT

TGGGT
SGGGT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LSLCAYFPAYLDAHAAAGVGVGNVDIPGFRIPKSSVPQALHDPDHLFTQQFVANGRCLVACDGILVNTFD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T













GGGS
GGGGSTTSGGGSSSS
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence AFEPDAVTALRQGSITVSGGFPPVFTVGPMLPVRFQAEETADYMRWLSAQPPRSVVYVSFGSRKAIPRDQ
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTSTTTSSS






S







SS

TS
TT


SS



 .........290.........300.........310.........320.........330.........340.........350
Sequence LRELAAGLEASGKRFLWVVKSTIVDRDDTADLGGLLGDGFLERVQGRAFVTMGWVEQEEILQHGSVGLFI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




SSTT


TT
TTTTSS



TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SHCGWNSLTEAAAFGVPVLAWPRFGDQRVNAALVARSGLGAWEEGWTWDGEEGLTTRKEVAKKIKGMMGY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


T




STTTS
TTS

TT






 .........430.........440.........450.......
Sequence DAVAEKAAKVGDAAAAAIAKCGTSYQSLEEFVQRCRD
Predicted secondary structure




SS confidence




































Known secondary structure (DSSP) STTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D