Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lcgA_

Fold library idPDB HeaderMoleculeTitle
c6lcgA_2.70PDB header: hydrolaseChain: A: PDB Molecule: n-carbamoyl-d-amino-acid hydrolase;


Added to library: Sat Oct 31 08:44:50 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTRRIRIGGAQMGAISRSDSKKEIVDRLIALLRQASEKGCELVVFPELALSTFFPRWYAERDGMDGYFED
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTB



TTS
TT
S

TTTTS

GGGS


SSTTGGGSBS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GMPNAATLPLFEEARRLGIGFSLGYAELVQEDGRVRRFNTTVLVERNGEIVGKYRKIHLPGHAEYEPERS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSS
TTTTT

SSS
TTS


S

S
SS

TTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence HQHLEKRYFEVGNTGFQVWDAFGGRVGMAICNDRRWVETYRVMGLQNVELILIGYNTPVNDSSETLGMFH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S






SS
S
TTGGGGG
TTT



B




 .........220.........230.........240.........250.........260.........270.........280
Sequence NHLTMQAGAYQNSTWVVGVAKAGVEDGHRLMGGSVIVAPTGEIVAQAMTEGDELIVADCDLDRCRYYKSH
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTT
B
TT




TTS


SSSSGGGGT
 .........290.........300...
Sequence IFNFAAHRRPEFYQRITSQTGVE
Predicted secondary structure









SS confidence






















Known secondary structure (DSSP) TT


GGG

SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D