Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6l54A_

Fold library idPDB HeaderMoleculeTitle
c6l54A_3.43PDB header: transferase/transcriptionChain: A: PDB Molecule: serine/threonine-protein kinase smg1;


Added to library: Sat Apr 18 17:51:06 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SADPDNLKYSNSAVVSRQRHDDTHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVTSPEFTSVQH
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

T

GGGG


TTTTS
STTTGGGTS

SSSSTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GSRALATKDMRKSQERSMSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPENKLVLVKQLDNIL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SSSSSS
SGGGTTTTTSTTTTS
SS


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence AAVHDVLNESSKLLQELRQEGACCLGLLCASLSYEAEKIFKWIFSKFSSSAKDEVKLLYLCATYKALETV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTGGGSS

SSTTS
S
TSS
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence GEKKAFSSVMQLVMTSLQSILENVDTPELLCKCVKCILLVARCYPHIFSTNFRDTVDILVGWHIDHTQKP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT

SS

SSTS

S


TT
SSS


GGGTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence SLTQQVSGWLQSLEPFWVADLAFSTTLLGQFLEDMEAYAEDLSHVASGESVDEDVPPPSVSLPKLAALLR
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
SS


SSS

STTSSSSTT

SS
SSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence VFSTVVRSIGERFSPIRGPPITEAYVTDVLYRVMRCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TT




TTS

S





STGGGGTSSS





SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence HCDMVITYGLDQLENCQTCGTDYIISVLNLLTLIVEQINTVVAVAHAVYQAVLSLKNIPVLETAYKLILG
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TTTS
SS






TSS


 .........500.........510.........520.........530.........540.........550.........560
Sequence EMTCALNNLLHSAFKNHVFNVDNAKFVVIFDLSALTTIGNAKNSLIGMWALSPTVFALLSKNLMIVHSDL
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) T


GGGS

TTTTSS

SSTTTTS



S
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence AVHFPAIQYAVLYTLYSHCTRHDHNLLGILLKKDNLNQDTRKLLMTWALEAAVLMKKSETYAPLFSCKGL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TSSSTTTS
SSSTT

TTTTT



TTTSS

S


TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence LANTLVEDVNVCRVQLVHSGTRIRQAFGKLLKSIPLDVVLSNNNHTEIQEISLALRSHMSKAPSNTFHPQ
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTTT





S


SSSSS
TTSSSTTTTS



TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence DFSDVISFILYGNSHRTGKDNWLERLFYSCQRLDKRDQSTIPRNLLKTDAVLWQWAIWEAAQFTVLSKLR
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T


STTTTTTTTT

TTS



GGGGS

TTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence TPLGRAQDTFQTIEGIIRSDEGHGNNQLRLVLLLQYLENLEKLMYNAYEGCAPKVIRTFFYTNRQTCQDW
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT
T


TTTT

TT


TTT
SSTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence LTRIRLSIMRVGLLAGQPAVTVRHGFDLLEVTIMMVVEALCELHCPEAIQGIAVWSSSIVGKNLLWINSV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTSS




S


TTTTT




SSGGGSTTTTS

TTSSS

 .........920.........930.........940.........950.........960.........970.........980
Sequence AQQAEGRFEKASVEYQEHLCAMTGVDCCISSNYLGNKACECYISIADWAAVQEWQNAIHDLKKDPRELQK
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


STTTGGGG
STTSSS









SS

TTTT

T
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence SIEVQLLRSSVCLATALNPIEQDQKWQSITENVVKYLKQTSRIAIGPLRLSTLTVSQSLPVLSTLQLYCS
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TGGGSS


S

STTS

SS














T
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence SALENTVSNRLSTALRYTMYQNQLLEKIKEQTVPIRSHLMELGLTAVQLGKTTTAQDLVQHFKKLSTQGQ
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)




TTS

SS


TT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence VDEKWGPELDIEKTKLLYTAGQSTHAMEMLSSCAISFCKSVKAEYAVAKSILTLAKWIQAEWKEIPRIES
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S

SS
TT

SS

TTTTGGGGGTT


S
GGGGG



S
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence ESTVHIGVGEPDFILGQLYHLSSVQAAKSWAALASWAYRWGRKVVDNASQGEGVRLLPREKSEVQNLLPD
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) SS




T

S
TTS


TS



S
SS
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence TITEEEKERIYGILGQAVEDDMVDVIWRQLISSCTEGVIKVWRKVVDRIFSLYKLSCSAYFTFLKLNAGM
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) S

T



T

 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence IVMATLRLLRLLVKHAGELRQYLEHGLETTPTAPWRGIIPQLFSRLNHPEVYVRQSICNLLCRVAQDSPH
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
SSTTSSS

SS

TTT
GGGTTTTT
SSTTSS
GG
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence LILYPAIVGTISMQDCYSKIVDKLSSANPTMVLQVQMLVAELRRVTVLWDELWLGVLLQQHMYVLRRIQQ
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) GSSSSST

SSSS

TTTTT
TT
 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence LEDEVKRVEKHTALMKPIVFALEHVRSITAAEKWFQDNYGDAIENALEKLKTPLSWIPFKEIMLSLQQRA
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)


SGGGG



TTTTTTTTTTTTT



TT
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence QKRASYILRLEEISPWLAAMTNTEIALPGEVVTIHSVGGTITILPTKTKPKKLLFLGSSYPYLFKGLEDL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TSSS



TTSS
T







TT





S

S


TTSS












TT

T
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence HLDERIMQFLSIVNTMFATINRQETPRFHARHYSVTPLGTRSGLIQWVDGATPLFGLYKRWQQREAALQA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTT
SS
SS









STT




SS
 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence QKIVPRPSELYYSKIGPARRDWPLHVMKAVLEELMEATPPNLLAKELWSSCTTPDEWWRVTQSYARSTAV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) T




TTTTS







SSTTS
TTT
SS
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence MSMVGYIIGLGDRHLDNVLIDMTTGEVVHIDYNVCFEKGKSLRVPEKVPFRMTQNIETALGVTGVEGVFR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S





TTTB
TTT



B


SS
SSGGGTSSS




SS


TTSSS
STTS
 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence LSCEQVLHIMRRGRETLLTLLEAFVYDPLVDWTAGNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTSS
SSS




TTTT
SS
TTS


 .........1900.........1910.
Sequence IKEATNLDNLAQLYEGWTAWV
Predicted secondary structure










SS confidence




















Known secondary structure (DSSP) TT
SS
GGG
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D