Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6kyrA_

Fold library idPDB HeaderMoleculeTitle
c6kyrA_2.21PDB header: signaling proteinChain: A: PDB Molecule: serine/threonine-protein kinase dclk1;


Added to library: Sat Sep 26 10:00:27 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




SS
TTT

TT
TT


TTB
 .........80.........90.........100.........110.........120.........130.........140
Sequence LLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

SS


S
BS
SS

TT



SGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence YEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRG
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)
TTS



SS

SS
B



S
TTT

TS
B
TTSS
S


 .........220.........230.........240.........250.........260.........270.........280
Sequence DQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
T




TTTTTTS
T
SSTTTS

TSSTTSS

SS



 .........290.........300.........310.
Sequence GKIKKHFTAAGVSVIATTALDKERQVFRRRR
Predicted secondary structure















SS confidence






























Known secondary structure (DSSP)



GGG










Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D