Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6kmfB_

Fold library idPDB HeaderMoleculeTitle
c6kmfB_3.60PDB header: cell adhesionChain: B: PDB Molecule: major fimbrium subunit fima type-1;


Added to library: Sat Apr 18 08:23:55 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AFGVGDDESKVAKLTVMVYNGEQQEAIKSAENATKVEDIKCSAGQRTLVVMANTGAMELVGKTLAEVKAL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



STTTS

SSSSSSSS







S



S


TT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence TTELTAENQEAAGLIMTAEPKTIVLKAGKNYIGYSGTGEGNHIENDPLKIKRVHARMAFTEIKVQMSAAY
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)


GGGTTS










SS

SSSS
SSSS
SS



B
S


B


TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DNIYTFVPEKIYGLIAKKQSNLFGATLVNADANYLTGSLTTFNGAYTPANYANVPWLSRNYVAPAADAPQ
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TTT


B

B

B


SSSSS


S



BBSS
S



SS

SS

B
SSS

B



SSSS

 .........220.........230.........240.........250.........260.........270.........280
Sequence GFYVLENDYSANGGTIHPTILCVYGKLQKNGADLAGADLAAAQAANWVDAEGKTYYPVLVNFNSNNYTYD
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)




SSS




TTB
S
TTSTT


SSSTT


TT


S
 .........290.........300.........310.........320.........330.......
Sequence SNYTPKNKIERNHKYDIKLTITGPGTNNPENPITESAHLNVQCTVAEWVLVGQNATW
Predicted secondary structure





























SS confidence
























































Known secondary structure (DSSP) TT



S
SS


B
S

BSSTTS


























Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D