Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6khqB_

Fold library idPDB HeaderMoleculeTitle
c6khqB_2.30PDB header: lyaseChain: B: PDB Molecule: cystathionine gamma lyase;


Added to library: Sat Mar 28 09:08:52 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVIAALENGKHG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


SS

S
TTT

SS





SB


SBTTB
SSS
SBTTT

TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence FAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFVDTTHTDSIVQAIRPTTKML
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSTTS
TT
TT

TGGGGT

TTSTT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQNPLDLGIDIVLHSATYLGGHSDVVAGLVA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
SS
TTT




TT

TTTB
GGGGT
S



S
SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence TSDDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIES
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S


B

TTT
TT


TTSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence HLNHDVHMAQADGHTGVIAFEVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMPADIRAKEGITDG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) STTBSS

S
SS
SS

S


SSS

TTT

TT

TT
 .........360.........370.....
Sequence LVRISVGIEDTEDLVDDLKQALDTL
Predicted secondary structure




SS confidence
























Known secondary structure (DSSP)

SS
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D