Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ka4B_

Fold library idPDB HeaderMoleculeTitle
c6ka4B_3.40PDB header: membrane proteinChain: B: PDB Molecule: f22l4.1 protein;


Added to library: Sat Sep 26 15:08:48 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDQFREIGEVLGSIRALMVFKDSIQINQRQCSLLLDLFTAAYESISVSMRSNLRFKEKNTKWKILEQPLR
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

STGGG
SS


GGGTTTTTGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELLWVVREGEAYVRMSLEPKLGFWAKAIVLHSNRDCTELHIHNLLSCLPIIVEAIETASEVSGWDEEEMS
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)
SSS
TT

TT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KKRLVHSNKYMKQWNDSQMFTWKFGREYLVTEDFCNRFESAWTEDRWILIKELQEKKQSGSSKHERKMAD
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) S
TT

STGGGT

TTT
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FLLKHLGDGNESPKLFPSSLLDNTKDYQVKKRLQYKEITWLGESFALRHFFGDIDALLPQITPLLSLSHP
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTSTT




TSS







TTSS
S
TTGGG


T
 .........290.........300.........310.........320.........330.........340.........350
Sequence NIVYYLCGFTDEEKKECFLVMELMRKTLGMHIKEVCTLSLPVAVDLMLQIALGMEYLHSKRIYHGELNPS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TB

SSS
S



B



TT


S


ST
 .........360.........370.........380.........390.........400.........410.........420
Sequence NILVKPRSNQSGDGYLLGKIFGFGLNSVPFIWYSPEVLEEQKYSDKSDVYSFGMVSFELLTGKVPFEDSH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T

SSS
SS



S




TTSS
T




TTTT
S
S
SGGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence LQGDKMSRNIRAGERPLFPFNSPKFITNLTKRCWHADPNQRPTFSSISRILRYIKRFLALNPECYSSIAP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GSSSTTT





TTS
S
SSTTTS


GGGT




 .........500.........510.........520.........530....
Sequence TVDYCEIETKLLQKLSWESTELTKVSQVPFQMFAYRVVERAKTC
Predicted secondary structure

























SS confidence











































Known secondary structure (DSSP) SS
TGGG
SS

GGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D