Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6k1tA_

Fold library idPDB HeaderMoleculeTitle
c6k1tA_1.58PDB header: hydrolaseChain: A: PDB Molecule: alpha/beta hydrolase fold family protein;


Added to library: Sat Apr 18 08:53:50 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PYHPALESLLDTPEIRKIKKLDLRDQRKIFADLSIAQIKRLPRPDIIEEDIKLENDTILRHYKPKKASDK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TT

TS
TS


S

TTS

SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence AVLFIHGGGWCLSSIDTYDHVCRYLCDQGNLNIFSLEYGLGPEDKYPAAVNHALYAYDWLYENITKFNLS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

STTTS

GGGGT



TTTS
TTGGGGT

 .........150.........160.........170.........180.........190.........200.........210
Sequence TENIFVMGDSAGGNLVTIICHERQENMPKAQILVYPAVDMYTKYDSNTKFDEYKYHLTTEWCELFLKAYI
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) GGGT
GGG

SS



SS


TT
SGGGS

T
 .........220.........230.........240.........250.........260.........270.........280
Sequence GPKKLRQPTISPLFYKDTNQPDTLIVAATHDILIDGIYAYEEKLKQQGTYVETHYDDEMYHGFIGGLGVV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

GGG
STTT
GGG

S



STTTT

TTGGGGTTTS
 .........290.........
Sequence PFENPKIALDKIIEFINKR
Predicted secondary structure


SS confidence


















Known secondary structure (DSSP) S
ST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D