Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6jw6B_

Fold library idPDB HeaderMoleculeTitle
c6jw6B_2.80PDB header: oxidoreductaseChain: B: PDB Molecule: dehydrogenase;


Added to library: Sat Apr 18 09:04:29 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PVRVGVVGAGFMGGVHAEVVAAHPGARLEAVHDLDPAAARDLAERFRAERAEPSWADLLADPAIDLLIIT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


ST
TT
SST
S



SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence TPNGLHHRQAAEALRAGKHVLVEKPLGVTPEQVAELVELAGRHDRVLAHGSNFVHSPKFVRARQLVADTE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S
GGGTT

SSS
SSTT




GGG
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence AFGRPHLVRVVFRNSGPEAAWAASKDLAGGGALLDLGCHAVELCRWLLDGADVESVSARLQRVRPPALED
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S
S


SGGGG
SSSTTTT



S




S
 .........220.........230.........240.........250.........260.........270.........280
Sequence QALLVMEFADGAVGQCDVSWVTQGGEQVTAEIIGTKGRVEVDLWTGMGLRAYSDKGYQDVWDPEQGWVHP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTS
S


SS
SS
STT
SS

SS

TT

SS
S

 .........290.........300.........310.........320.........330.........340.
Sequence EWEWIRASGYYHQDGTVIEAVGQGIPLTHGPAEALASARVLATGYRSHAEGRVLRLSGAPV
Predicted secondary structure























SS confidence




























































Known secondary structure (DSSP)
SSTS



SS
TTS
B
TTS
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D