Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6jufA_

Fold library idPDB HeaderMoleculeTitle
c6jufA_1.59PDB header: hydrolaseChain: A: PDB Molecule: sspb protein;


Added to library: Sat Mar 28 08:26:31 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DSRLAEAAHSSFARHETFAPRFGWLHKAYMQVQSNPEAFLADDAPVQLGVGKNMVYAMRYWSRAFKLTRE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

B
S

STTTT



TT
TTTTTSTTTS
GGGTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence HYGDDTNSRAMLSYPTWEARWLLDEDGADPYLEELGSLWLLHWWLLSSRPGTKSWAPSWYVAFHLAPFSR
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
S
SS



STTSS
TT

S

BTTB
BS
T
S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTLADLTQVIVRHVNLSFPEGPVEASIAKDVDCITKMYVPAQRLRGGEDLLSCPFRELGLMEQVGQRGSS
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SS


S
GGG









GGGGG

S
SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence EWEFTSGSRPSLPARIIAYACLDYAARTTRNAGSISLARLANEPGAPGRAFRIREADIAAALEKVAASHQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

S

TTS
TT
SSSSTTST


T
 .........290.........300.........310.........320.........330.........340....
Sequence ELQLVEAVGQRSLTFTSGPFDLAWDVLDEQYDNVRSRPNFPTREDWARRYPKLAEAEKRELKQL
Predicted secondary structure
















SS confidence































































Known secondary structure (DSSP) TSSS
SS
TT
GGGSTT



T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D