Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6joiA_

Fold library idPDB HeaderMoleculeTitle
c6joiA_3.10PDB header: oncoproteinChain: A: PDB Molecule: platelet-derived growth factor receptor alpha;


Added to library: Sat Mar 28 09:31:39 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT




GGGS


TTSB

GGG
SS
SS
SS
S

SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence QALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIIIEYCFYGDLVNYLHKNRDSFLGLTLLDLLSFTYQV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


TTB


SSS



SSTTTT




 .........150.........160.........170.........180.........190.........200.........210
Sequence ARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TT


S

SSTT
TTS









GGGS
T



 .........220.........230.........240.........250.........260.........270.........280
Sequence IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTS

SSTT


ST





TT

T
SSGGGS

TTS
 .........290......
Sequence YKKSYEKIHLDFLKSD
Predicted secondary structure



SS confidence















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D