Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6joaC_

Fold library idPDB HeaderMoleculeTitle
c6joaC_2.10PDB header: oxidoreductaseChain: C: PDB Molecule: catalase;


Added to library: Sat Mar 28 08:41:57 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NKAISTVEPHYEDTAPAEPMMPGSDKTPKNRNEKLTQLDKFRFAPQGESLRTNQGVKISDNQNSLKSGAR
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
TS


S

S







TT


TT



TT


B
TTS
B
S
SS


BSSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GSTLLEDFILREKITHFDHERIPERVVHARGTGAHGYFQVYESLASYTTAEFLQDPSVKTPVFVRFSTVQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
B
TT
T





SSS
SSS

TTT


GGGS
TT


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GSRGSADTVRDIRGWATKFYTKEGTFDLVGNNTPVFFIQDAIKFPDFVHAVKPEPHNEIPQGQSAHDTFW
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) S
TTS
TTSSS

TTSSSS
S
SSGGGS
BTTTTB
TT


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DYISLQPETLHNVMWVMSDRGIPRSYRMMEGFGIHTYKMINAEGQCHFIRFHWKPVYGVSSLIWDEAQLL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
GGGSGGGSBS
GGGS


S

TT

TTB

B

 .........290.........300.........310.........320.........330.........340.........350
Sequence TGCDPDFHRRELWESIEAGDYPEYELGLQIIPEEDEHKFDFDILDPTKLIPESLVPVHLVGKMVLNRNPD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TTT


GGGTT
SSS
TT
TT



TTTS



S
 .........360.........370.........380.........390.........400.........410.........420
Sequence NYFSETEQVAFCPGNIVPGIDFSDDPLLQGRLFSYIDTQISRLGGVNFHEIPINKPICPFHNHQRDGMHR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
TTT



TT


TT


TTSTTGGGSGGG

SS



S



TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence MSISGTANYEPNSINNNWPREAPPTEGGFTTYPQPVNGYKSRKRSSTFIDFYSQPRLFWLSQTKVEQNHI
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)




S

SSS
STTTT
S



GGGT









S






GGG


STS
 .........500.........510.........520.........530.........540.........550.........560
Sequence VGGFSFELGKVVRPWIRERVVNQLTYIDHQLAQSVADNLGIKLSQEQLKHPLPGPINGLSKDRSLSMYDG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TT

STTT
TT



T





BTTBS

GGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence HHQILKSRQVAILAADGVCGDAIDNIMKTLKKYGVHGKIFAPHVGRITSLQGNEIEVNGTIEGNPSVMVD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
B

TT


TT

T
SSSS
TTS


TTTS
GGGSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence AVIIPDGEDSIDSLMKNGNAKHYVIQAFKHLKAIGLQGKAFKLYDALPLPKPDEGIVVGDKAADLAEAFC
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


T
TT
TTTSS

S

TTSS
 .........710.........720
Sequence NVMRGHRIWSRESVAQEIAG
Predicted secondary structure






SS confidence



















Known secondary structure (DSSP) TSSS
GGGTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D