Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6jivC_

Fold library idPDB HeaderMoleculeTitle
c6jivC_3.31PDB header: hydrolaseChain: C: PDB Molecule: sspe protein;


Added to library: Sat Mar 28 08:33:12 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XETKEIFDAAPLSVSQFLSETGQGLYIPPYQRAYSWELPKIRRLLSDVAHGLDQLAEFEDSICFLGTVIA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

SSTT

S
SS

TTS





TTSSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LRDINYTTVEPKYRSQVPSKVXTIIDGQQRXTTLLLLTTVLHEEIRVRAEKLTRDDEPSVWCYNQALDVT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SS
SS
SS

GGG

S
SS
SSSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GRLSNCFEEDXRYGEHRYYPRLIRSYYDVWSRNKGEARYRSPIGYYLESYVDLEAYRHLDRXRDQXRSXL
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)



SSSSSSSSS



S

S









 .........220.........230.........240.........250.........260.........270.........280
Sequence RKAVGAGVKREDDIQLPTGTDIGQSQNLQFALFNSEFPPSVVEQLEDDAKXTPLTRLIVFANYLLHRVTV
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTSS


SSS





TT
SS


TT
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence AVVTAKREDYGFDXFEALNTTGQPLTAIETFKPRAIKEEGLDEWQESESKLHFDVVEAYLDREGADKRQT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSS





TSSS
SS

SS


 .........360.........370.........380.........390.........400.........410.........420
Sequence VTSSVLLPFAXFQDGTKLTKRLNDQRRYLRTVFDKDPDIVARRKVLAGLAQVARFYEGPWGSPTKVPSCD
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS




S
TTS
TTTTTTT
S

S
SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence DATLRTQAGIALAALREGGHDIVVGLLTRYFAAHRLSSPETVESSARQFLLAARSCAAFYALWRGSFGST
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SGGGSS

TTSS
TTTSSSS
S
 .........500.........510.........520.........530.........540.........550.......
Sequence AGIDGVYRSLXTHVVEALQSYLKEQLRSEGIYDKQQWVARAAXTPVYQHSKPLTRLLLLAASQNSTP
Predicted secondary structure
















SS confidence


































































Known secondary structure (DSSP) S


TT

STTS
SSS
GGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D