Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6hcyA_

Fold library idPDB HeaderMoleculeTitle
c6hcyA_3.10PDB header: membrane proteinChain: A: PDB Molecule: metalloreductase steap4;


Added to library: Sat Oct 27 08:33:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



STTT

S
SS


S

TT


TTT
S
S
STT
GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) GGGGTTTSTT




SSTTSSSS

TTS
SSSS
S

SSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence DSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TT


SGGGGGG
SSSTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVAL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS




GGGTTTTTTSSS
SSS


SSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence GFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLP
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTGGGSS






TST
 .........360.........370.........380.........390.........400.........410.........420
Sequence SVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLI
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTSSSS
TTTTT
TTS
SSS


SSSSTT
 .........430......
Sequence MPCVDNTLTRIRQGWE
Predicted secondary structure



SS confidence















Known secondary structure (DSSP) SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D