Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6gybU_

Fold library idPDB HeaderMoleculeTitle
c6gybU_3.28PDB header: membrane proteinChain: U: PDB Molecule: virb10 protein;


Added to library: Sat Oct 27 08:52:43 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTLLERRILAESGPVTLAKPISNPDGLLVRGTYIRCILETRIISDFGGYTSCIVTEPVYSINGHNLLLPK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

ST









S
GGG
TT

S
SSS


S

SSSSS
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GSKMLGQYSAGEPTSHRLQVVWDRVTTPTGLDVTLMGPGIDTLGSSGHPGNYNAHWGNKIASALFISLLS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T






SSS


TTS




TTS
BS


 .........150.........160.........170.........180.........190.........200.....
Sequence DAFKYAAAEYGPEPFESNTARSMQQLAEQAVEKSGRRPATLTINQGTVLNVYVAKDVDFSAVLPK
Predicted secondary structure



























SS confidence
































































Known secondary structure (DSSP) SSS





STS



TT


S

TTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D