Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6g9oA_

Fold library idPDB HeaderMoleculeTitle
c6g9oA_4.25PDB header: membrane proteinChain: A: PDB Molecule: volume-regulated anion channel subunit lrrc8a;


Added to library: Sat May 19 09:38:51 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSTGPTGIKYDLDRHQYN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

TTTTS





SSBSSSSB













 .........80.........90.........100.........110.........120.........130.........140
Sequence YVDAVCYENRLHWFAKYFPYLVLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETG
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTS
ST


 .........150.........160.........170.........180.........190.........200.........210
Sequence VLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFALIICYTVYYVHNIKFDVDCTVDIE
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)


TT


GGG

S


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence SLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKKYSFESIREESSYSDIPDVKN
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTTS


TT
TTSB

T





B
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence DFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRLTKNAQDKLELHLFMLSGIPD
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT
GGG
S


TTS
S
SS

G
 .........360.........370.........380.........390.........400.........410.........420
Sequence TVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAFLRENLRALHIKFTDIKEIPL
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) GGGG
TT

S

S

GGGGG
TT

S



S
S
SSGGGS
G
 .........430.........440.........450.........460.........470.........480.........490
Sequence WIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTK
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) GGGG
SS

S



TT
TTSTTGGGGG
TT

S

SB

TTT


TT

 .........500.........510.........520.........530.........540.........550.........560
Sequence LIVLNSLKKMVNLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNH
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)
B
TT
GGG
TT

S



S

GGGGG
TT



S


S

GGGGGGGG
TT



SS
 .........570.........580.........590.........600.........610.........620.........630
Sequence IAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFLPADIGLLQNLQNLAVTANRI
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)




GGGGG
TT



SS





GGGGG
TT



SS





GGGGG
TT


TTS

 .........640.........650.........660.........670.........680.........690.........700
Sequence EALPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDL
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
S

GGGGG
TT



SS





GGGGG
TT



SS

SS

GGGGG
TT

TTT

 .........710........
Sequence FSTLPPEVKERLWRADKE
Predicted secondary structure






SS confidence

















Known secondary structure (DSSP) TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D