Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6g3eA_

Fold library idPDB HeaderMoleculeTitle
c6g3eA_1.90PDB header: lyaseChain: A: PDB Molecule: argininosuccinate lyase;


Added to library: Sat May 19 08:39:29 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VPDATRIGRATGAKAPEFQELYDFDAAALTLTSAVFPYDSQIHRAHVVMLTEQGILTVEESATILSGLAQ
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


TT

TTS
S





TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VDELAATDGSLRTYLPYEAALKRTIGSVAGKMHIGRSRNDLANAGKRMFLRDQLLRTIEAVIGYREAVVH
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT
GGGSS
GGGGGGGTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence KAADHLDTVMVVYTQRKEAQPITLGHYLMAISENLAKNLDRYRELYARINLCPLGAAATAGTGWPLNRDR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
TT
TTS
B
TT
TTTT

SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence TSALLGFDGLVVNSIEGVAGWDHVAEHAFVNAVFLSGLSRLASEIQLWSTDEYQVAELDASFAGTSSIMP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
SSB

S

TSTTT
S

GGG
B

SS
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence QKKNPDSLERSRKAAFAAMGPLVGILTSLNAIEYQYSAARVELEPRSIDALIAATHAMTGVVRTLHPNKE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T

B
TTS
SS

TT






 .........360.........370.........380.........390.........400.........410.........420
Sequence RMRQYAAENYSTMTDLTDMLVRRVGIDYREAHEIVAHVVITAIEKGIKANKIGLDLVQEAAVAQTGAGIN
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSTT


T

GGG

SS


 .........430.........440.........450.........460.........470.........480.........490
Sequence VSADDIKDALDPWQNVLRREGKGMPAPMSVKASIDDAMAELHKDRAWLANATQALANAKQTLADSVQQII
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)

T


STTSSS
 .......
Sequence QTDRKYL
Predicted secondary structure


SS confidence






Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D