Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fwnA_

Fold library idPDB HeaderMoleculeTitle
c6fwnA_UNKPDB header: blood clottingChain: A: PDB Molecule: von willebrand factor;


Added to library: Sat Oct 27 08:26:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSMASACEVVTGSPRGDSQSSWKSVGSQWASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQ
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



S

TTT

TT

SSSS
TT




SS




SS

 .........80.....
Sequence LSCKTSACCPSCRCE
Predicted secondary structure








SS confidence














Known secondary structure (DSSP)

SSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D