Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fvqE_

Fold library idPDB HeaderMoleculeTitle
c6fvqE_3.30PDB header: membrane proteinChain: E: PDB Molecule: cys-loop ligand-gated ion channel;


Added to library: Sat May 19 08:30:11 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPSDVFIGLKIDQITGINQKEENFSVVGSLRIDWRQPLLAFEHAPGEPKHRTYTLATFLKLLEEKQIRWP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TTTT
GGG




TTS
STT



 .........80.........90.........100.........110.........120.........130.........140
Sequence AFTYHNQQGAMDFQNRLISLSEDGTVMYLERFTSTFQAPAFDFRLFPFDNQLFFIHVDSIFPQHLFRFQE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTTT

TT


TTTTS
SS
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence MQGFSGLGDQLGEEEWIVTEVNTHLTTHNEFTKGDASRFVLEFHAERHLNYYLMRILIPVLLIITVSWFT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TTT

S



SS
SS
SS

TTG
 .........220.........230.........240.........250.........260.........270.........280
Sequence FFLQDYTKRIDLAGGNLLLFIAFNFTISSDLPRLGYITLMDAFLVGTFIITALVVLGNVWLRRLENHGQA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) GGG

TTS


SS

T

 .........290.........300.........
Sequence LARKLDIYAITSYPLAYLLGALTLWLLFF
Predicted secondary structure
SS confidence




























Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D