Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fv3D_

Fold library idPDB HeaderMoleculeTitle
c6fv3D_2.58PDB header: hydrolaseChain: D: PDB Molecule: n-acetylglucosamine-6-phosphate deacetylase;


Added to library: Sat May 19 08:50:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMLLTADTVLTGTELLRPGWLEIASDRVVAVGAGAPPAQADRNLGAATVVPGFVDTHLHGGGGGNFSAAT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

S
SS
SS

TTB

SS
SS

S

S


TTGGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence DDETARAVALHRAHGSTTLVASLVTAGPEDLLRQVSGLARQVRAGLIDGIHLEGPWLSTLRCGAHQPVLM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT



TS
S
SS



STT
S
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence RDPDPGEIGRVLDAGEGTVRMVTIAPERDGALAAIAQLVNAGVVAAVGHTEATYDQTRAAIDAGATVGTH
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)



TT

TTSTTTT

SB


T

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LFNAMRPIDRREPGPAVALTEDSRVTVEMIVDGVHVAPAIYRHITQTVGPERLSLITDAMAATGMSSTAT
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TTSSB



SS


STT

SSSSS

TTS



TTTT





 .........290.........300.........310.........320.........330.........340.........350
Sequence MEQVFRLAVAHCGLPRDDALSLAVRQACVNPARALGLPAAGLAAGARADLVVLDHDLAVTAVMRAGEWVV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
S
TTT





STTSB


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D