Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6friD_

Fold library idPDB HeaderMoleculeTitle
c6friD_2.30PDB header: oxidoreductaseChain: D: PDB Molecule: alkanal monooxygenase beta chain;


Added to library: Sat Mar 3 08:37:20 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MNFGLFFLNFQLKGMTSEAVLDNMIDTIALVDKDEYHFKTAFVNEHHFSKNGIVGAPMTAASFLLGLTER
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)





TT

TSTT







SSSS


S

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LHIGSLNQVITTHHPVRIAEEASLLDQMSDGRFILGLSDCVSDFEMDFFKRQRDSQQQQFEACYEILNDG
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

TTS
TTS




TT

STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ITTNYCYANNDFYNFPKISINPHCISKENLKQYILATSMGVVEWAAKKGLPLTYRWSDTLAEKENYYQRY
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SSSS

SS

SSGGGS


TT


TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LTVAAENNVDITHVDHQFPLLVNINPDRDIAKQEMRDYIRGYIAEAYPNTDQEEKIEELIKQHAVGTEDE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT


TT


SS
TTS
T
TT
 .........290.........300.........310.........320.
Sequence YYESSKYALEKTGSKNVLLSFESMKNKAAVIDLINMVNEKI
Predicted secondary structure









SS confidence








































Known secondary structure (DSSP)

TTT
TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D