Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fo2R_

Fold library idPDB HeaderMoleculeTitle
c6fo2R_4.40PDB header: membrane proteinChain: R: PDB Molecule: cytochrome b-c1 complex subunit rieske, mitochondrial;


Added to library: Sat Mar 3 08:37:04 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTT





TTTS
GGG

TTS
SSSSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence MSKIFKWRGKPLFVIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANYCPCHGSHYDAS
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) TT


TT
B

TTGGGS
TTTSSS


GGGT
SSTT


BB


TTTS






BTTTTB
SS
 .........150.........160........
Sequence GRIRKGPAPLNLEVPSYEFTSDDMVIVG
Predicted secondary structure

















SS confidence



























Known secondary structure (DSSP)

SS

S

B



SSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D