Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fkxD_

Fold library idPDB HeaderMoleculeTitle
c6fkxD_2.03PDB header: hydrolaseChain: D: PDB Molecule: acetyl xylan esterase;


Added to library: Sat Mar 3 09:10:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HVPLTFDLPFEELLTYPGRTPRPADHDEYWDRGLADLAAVPADVVIEPAEFTTPLARCSHLWFTGTGGVR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




SS

TT


SS


TTTS




S

BTTBTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VHAKLLRPVAPVEPHPALLQFHGYTGNSGDWSSRLHYVALGYTVAALDCRGQAGLSVGEAPVENWSMASY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
SS

S


TT

S

GGGGTT


TTSSSS






SS

TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLRGIDDDAADNLALRHLFLDTARLAQIVLAMDDVDPDRVAATGYSQGGGLTLACAALEPRIRLAAPVYP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTTTTSSSGGG
STTTSTT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FLCDFRRAWEMDLEKGPYNEITTYFRARDPRHLREEEIFSRLGYVDVQHLAPRVRAEVLMTVSLADKICP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S

T

SSSTT
TT
TTT
GGG

STT
SSS
 .........290.........300.........310.........320..
Sequence PSTQFAAYNKLGGPKDYRLYPDFAHETLPGTDDAIFTFLQGL
Predicted secondary structure













SS confidence









































Known secondary structure (DSSP) TT
SS
TT

SS

TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D