Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fkxD_

Fold library idPDB HeaderMoleculeTitle
c6fkxD_2.03PDB header: hydrolaseChain: D: PDB Molecule: acetyl xylan esterase;


Added to library: Sat Mar 3 09:10:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HVPLTFDLPFEELLTYPGRTPRPADHDEYWDRGLADLAAVPADVVIEPAEFTTPLARCSHLWFTGTGGVR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




SS

TT


SS


TTTS




S

BTTBTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VHAKLLRPVAPVEPHPALLQFHGYTGNSGDWSSRLHYVALGYTVAALDCRGQAGLSVGEAPVENWSMASY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
SS

S


TT

S

GGGGTT


TTSSSS






SS

TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLRGIDDDAADNLALRHLFLDTARLAQIVLAMDDVDPDRVAATGYSQGGGLTLACAALEPRIRLAAPVYP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTTTTSSSGGG
STTTSTT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FLCDFRRAWEMDLEKGPYNEITTYFRARDPRHLREEEIFSRLGYVDVQHLAPRVRAEVLMTVSLADKICP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S

T

SSSTT
TT
TTT
GGG

STT
SSS
 .........290.........300.........310.........320..
Sequence PSTQFAAYNKLGGPKDYRLYPDFAHETLPGTDDAIFTFLQGL
Predicted secondary structure













SS confidence









































Known secondary structure (DSSP) TT
SS
TT

SS

TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D