Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fg7A_

Fold library idPDB HeaderMoleculeTitle
c6fg7A_1.90PDB header: protein bindingChain: A: PDB Molecule: inactive lrr receptor-like serine/threonine-protein kinase


Added to library: Sat Jan 27 08:28:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ADEDDIRCLRGLKASLTDPQNALKSWNFDNTTLGFLCNFVGVSCWNNQENRVINLELRDMGLSGKIPDSL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



SB
TT
TTTT

SS


SSGGGGSTT
TT
TT

TTS




GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence QYCASLQKLDLSSNRLSGNIPTELCNWLPFLVSLDLSNNELNGEIPPDLAKCSFVNSLVLSDNRLSGQIP
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP) GG
TT



SS
S


TTSTT
S

SS



GGGGG
TT
S

SS


 .........150.........160.........170.........180.........190...
Sequence VQFSALGRLGRFSVANNDLSGRIPVFFSSPSYSSDDFSGNKGLCGRPLSSSCG
Predicted secondary structure











































SS confidence




















































Known secondary structure (DSSP) GGGGG
TT



SS

GGGGSTTS
GGGGTT
TSTTSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D