Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fflA_

Fold library idPDB HeaderMoleculeTitle
c6fflA_1.71PDB header: sugar binding proteinChain: A: PDB Molecule: maltose/maltodextrin transport permease homologue;


Added to library: Sat Jan 27 09:00:34 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VRIQIWHQMIYGHRQVLAEALEKFEKENPGITVQATYRETEELRSSFQSAAMGGSGPELVYGPSDQVGPF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)



STT


TT


SGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ATMGIVRPLDEVLGSDYFQNFDPLAAPVYDGKHYMIGDAVGNHLMLLYNKKFITTPPKNSQELIELGKKM
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT
B

S
TTB
GGGS
TT

SB

TTT
SS

SB
 .........150.........160.........170.........180.........190.........200.........210
Sequence TVDTNGDGKIDRWGLVFNYTEPFFFAPFIPAFGEAFLKADGVTPNLNTTALKDTFQFILKLRDQDKIIPK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
B
TTSSS

SB

TTSTTTSS
SB
TTSSSB

SSTS

S
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ECDYETANALFKENKAAMLINGDWSWGDYQQAKVDFGIARIPMISETGKWPSPLVGTKGYSLNANMKSEA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

TT
GGGTT




BBTTTTB



B
BS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence HYEAAVKLLKYLTSTPVQLLFAEKVGVLPSNLQARESDIVKNNPLLKISADIMEVGTPMPVTPEVRAVWD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS

SBTGGGGST
TTT



ST
 .........360.........370.........380...
Sequence SLRIQYQKVLAGSLQPQAAAEQAQITAEQQIRD
Predicted secondary structure






SS confidence
































Known secondary structure (DSSP) TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D