Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fflA_

Fold library idPDB HeaderMoleculeTitle
c6fflA_1.71PDB header: sugar binding proteinChain: A: PDB Molecule: maltose/maltodextrin transport permease homologue;


Added to library: Sat Jan 27 09:00:34 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VRIQIWHQMIYGHRQVLAEALEKFEKENPGITVQATYRETEELRSSFQSAAMGGSGPELVYGPSDQVGPF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)



STT


TT


SGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ATMGIVRPLDEVLGSDYFQNFDPLAAPVYDGKHYMIGDAVGNHLMLLYNKKFITTPPKNSQELIELGKKM
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT
B

S
TTB
GGGS
TT

SB

TTT
SS

SB
 .........150.........160.........170.........180.........190.........200.........210
Sequence TVDTNGDGKIDRWGLVFNYTEPFFFAPFIPAFGEAFLKADGVTPNLNTTALKDTFQFILKLRDQDKIIPK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
B
TTSSS

SB

TTSTTTSS
SB
TTSSSB

SSTS

S
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence ECDYETANALFKENKAAMLINGDWSWGDYQQAKVDFGIARIPMISETGKWPSPLVGTKGYSLNANMKSEA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

TT
GGGTT




BBTTTTB



B
BS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence HYEAAVKLLKYLTSTPVQLLFAEKVGVLPSNLQARESDIVKNNPLLKISADIMEVGTPMPVTPEVRAVWD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS

SBTGGGGST
TTT



ST
 .........360.........370.........380...
Sequence SLRIQYQKVLAGSLQPQAAAEQAQITAEQQIRD
Predicted secondary structure






SS confidence
































Known secondary structure (DSSP) TTSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D