Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6feuJ_

Fold library idPDB HeaderMoleculeTitle
c6feuJ_3.00PDB header: oxidoreductaseChain: J: PDB Molecule: peroxiredoxin;


Added to library: Sat Jan 20 10:42:32 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFSKKYEEFKKLNTEL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

S
SS

TTSB



TT
TTTTSSS
S
TT
TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IGLSVDSNISHIEWVMWIEKNLKVEVPFPIIADPMGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLIL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS
SS



S


TTTT


TTTSSS


TTSB
 .........150.........160.........170.........180.........190.........200.........210
Sequence YYPMEIGRNIDEILRAIRALQLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTS




B

TTTTS
SSSTT

B




ST
TTSSSBTTB


 .....
Sequence EVKTT
Predicted secondary structure


SS confidence




Known secondary structure (DSSP)





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D