Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fd2B_

Fold library idPDB HeaderMoleculeTitle
c6fd2B_2.55PDB header: biosynthetic proteinChain: B: PDB Molecule: putative apramycin biosynthetic oxidoreductase 4;


Added to library: Sat Jan 20 10:41:30 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RLGTVLLVSPKTSFGRDLQRTYAGGLGTVCKDEDFLLPPLDLMRLAGVLREDADDIAIADEEVTGVVPSV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)





TTGGGTTTTTTT

TT


B


GGG
STTTT





 .........80.........90.........100.........110.........120.........130.........140
Sequence EPGTTVICHVSLPSLLEDAERLATFRAQGARCYAYTSIRSPAQWRTLFERGGCEGVLLPESISFARAALA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT


STTTT





TS

S

GGGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence GDHTVPGLVTPDSLLDPRHHQPAFGDLAAEPLPARDLVDHTPYMFPPIARTGITSINGSFGCPYPCRFYC
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) T

SSTT
SSSTT
TTTTS




GGG




GGGS

TT
BBTTTBSSS
S



GGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PYPLSEGRKIRTYPVERIVAEFRQCAELGITAAVFRDPVFSFHRDRTLELCQALKAADTGVPWWCETRID
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
SS


T



TTTTSST





GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence RLDEEVVAALVDAGCVGVEVGVESGDPDMQATAVRKRLNLDTVRKFHAVARKAGLKLVFLFLIGLPRETR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) G

T
S
TTTT
S


TT


TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence MSIRRTFDFILELGLADTEFNLSVITPYPGTELHQIAVDKGWIDGSQNAFTSHNAVMHTDELSIGDLERA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T

GGG



TTSTT
B
S
GGG

TTS

B

SS

 .........430.........440.........450....
Sequence SRFVDELHAVCKAGPAERAEFQARVHAWSTGDAM
Predicted secondary structure










SS confidence

































Known secondary structure (DSSP) S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D