Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fd2B_

Fold library idPDB HeaderMoleculeTitle
c6fd2B_2.55PDB header: biosynthetic proteinChain: B: PDB Molecule: putative apramycin biosynthetic oxidoreductase 4;


Added to library: Sat Jan 20 10:41:30 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RLGTVLLVSPKTSFGRDLQRTYAGGLGTVCKDEDFLLPPLDLMRLAGVLREDADDIAIADEEVTGVVPSV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)





TTGGGTTTTTTT

TT


B


GGG
STTTT





 .........80.........90.........100.........110.........120.........130.........140
Sequence EPGTTVICHVSLPSLLEDAERLATFRAQGARCYAYTSIRSPAQWRTLFERGGCEGVLLPESISFARAALA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT


STTTT





TS

S

GGGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence GDHTVPGLVTPDSLLDPRHHQPAFGDLAAEPLPARDLVDHTPYMFPPIARTGITSINGSFGCPYPCRFYC
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) T

SSTT
SSSTT
TTTTS




GGG




GGGS

TT
BBTTTBSSS
S



GGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PYPLSEGRKIRTYPVERIVAEFRQCAELGITAAVFRDPVFSFHRDRTLELCQALKAADTGVPWWCETRID
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) S
SS


T



TTTTSST





GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence RLDEEVVAALVDAGCVGVEVGVESGDPDMQATAVRKRLNLDTVRKFHAVARKAGLKLVFLFLIGLPRETR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) G

T
S
TTTT
S


TT


TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence MSIRRTFDFILELGLADTEFNLSVITPYPGTELHQIAVDKGWIDGSQNAFTSHNAVMHTDELSIGDLERA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T

GGG



TTSTT
B
S
GGG

TTS

B

SS

 .........430.........440.........450....
Sequence SRFVDELHAVCKAGPAERAEFQARVHAWSTGDAM
Predicted secondary structure










SS confidence

































Known secondary structure (DSSP) S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D