Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fcxA_

Fold library idPDB HeaderMoleculeTitle
c6fcxA_2.50PDB header: oxidoreductaseChain: A: PDB Molecule: methylenetetrahydrofolate reductase;


Added to library: Sat May 19 08:33:50 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ERHERLREKMRRRLESGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)




T




SSTT

S


GGG
TTSSSTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MMIASTAVNYCGLETILHMTCCRQRLEEITGHLHKAKQLGLKNIMALRGDPFNYAVDLVKHIRSEFGDYF
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS



SS

TT







STTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DICVAGYPKGHPEAGSFEADLKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT

TT
S





S
T

S





 .........220.........230.........240.........250.........260.........270.........280
Sequence GYHSLRQLVKLSKLEVPQEIKDVIEPIKDNDAAIRNYGIELAVSLCQELLASGLVPGLHFYTLNREMATT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SS




GGGTT
TTSS


TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence EVLKRLGMWTEDPRRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNFGELKDYYL
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) T
S
SS


SSSS




GGGTT


GGGTT
TT
SS


S
S









G
 .........360.........370.........380.........390.........400.........410.........420
Sequence FYLKSKSPKEELLKMWGEELTSEASVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) GGTS
SS

S


S

B
TTS
B


BTTB
S


GGGGGS
 .........430.........440.........450.........460.........470.........480.........490
Sequence RQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT


TT
TTT

SSTT


GGGTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence ENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIEQWGKLYEEESPSRTIIQYIHDN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


GGG


TTS


TTGGGS
TTS
 .........570.........580.........590......
Sequence YFLVNLVDNDFPLDNCLWQVVEDTLELLNAENLYFQ
Predicted secondary structure













SS confidence



































Known secondary structure (DSSP)


TTS


TTT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D