Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fahE_

Fold library idPDB HeaderMoleculeTitle
c6fahE_3.13PDB header: flavoproteinChain: E: PDB Molecule: caffeyl-coa reductase-etf complex subunit care;


Added to library: Sat Jan 27 08:24:51 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KVIEEKCIGCSKCQKSCPFDAITIENKIAVIGDACTNCGTCIDVCPTEAILQEGTEKIVRDLSMYKGVWV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)



TT





TTSSSTTS



SS





TT



SSTTTSSTT



S

S











 .........80.........90.........100.........110.........120.........130.........140
Sequence FAEQREGKIMPVVFELLGEGKKLANEIGTELCAILCGSNVAELTDELFAYGADKVYLADAPELEKYTTDG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


GGGS




SS

TTT
S
GGGSS

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence YSKIINEAIGLYKPEIVLYGATHIGRDLAPCLAVKVNTGLTADCTKLEIDPDDKKIRQTRPAFGGNLMAT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

SSSTTT
S
TTS
SGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IVCPGSRPQMSTVRPGVMDKAAYDPSQKGEVIKLDATFNEGDIRTKVLEIVKTTTDNISISDADFIVSGG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

TT
SS
TTSS


















SS

















TTT
S

 .........290.........300.........310.........320.........330.........340.........350
Sequence MGLGKPEGFELLKQLADKLGGTVATSRACVDAGWADHAQQVGQTGTTVKPQIYFACGISGAIQHIAGMQD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GGG
SGGGT


TTTSS
TTTB
SSSS




S
S



GGGTT
 .........360.........370.........380.........390...
Sequence SDIIIAINKNENAPIFEVADYGIVGDLYKVIPAIIEELDKIGK
Predicted secondary structure













SS confidence










































Known secondary structure (DSSP)
S
S
TT
GGGGT
SS
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D