Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fahE_

Fold library idPDB HeaderMoleculeTitle
c6fahE_3.13PDB header: flavoproteinChain: E: PDB Molecule: caffeyl-coa reductase-etf complex subunit care;


Added to library: Sat Jan 27 08:24:51 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KVIEEKCIGCSKCQKSCPFDAITIENKIAVIGDACTNCGTCIDVCPTEAILQEGTEKIVRDLSMYKGVWV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)



TT





TTSSSTTS



SS





TT



SSTTTSSTT



S

S











 .........80.........90.........100.........110.........120.........130.........140
Sequence FAEQREGKIMPVVFELLGEGKKLANEIGTELCAILCGSNVAELTDELFAYGADKVYLADAPELEKYTTDG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


GGGS




SS

TTT
S
GGGSS

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence YSKIINEAIGLYKPEIVLYGATHIGRDLAPCLAVKVNTGLTADCTKLEIDPDDKKIRQTRPAFGGNLMAT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

SSSTTT
S
TTS
SGGGT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IVCPGSRPQMSTVRPGVMDKAAYDPSQKGEVIKLDATFNEGDIRTKVLEIVKTTTDNISISDADFIVSGG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

TT
SS
TTSS


















SS

















TTT
S

 .........290.........300.........310.........320.........330.........340.........350
Sequence MGLGKPEGFELLKQLADKLGGTVATSRACVDAGWADHAQQVGQTGTTVKPQIYFACGISGAIQHIAGMQD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GGG
SGGGT


TTTSS
TTTB
SSSS




S
S



GGGTT
 .........360.........370.........380.........390...
Sequence SDIIIAINKNENAPIFEVADYGIVGDLYKVIPAIIEELDKIGK
Predicted secondary structure













SS confidence










































Known secondary structure (DSSP)
S
S
TT
GGGGT
SS
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D