Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fahD_

Fold library idPDB HeaderMoleculeTitle
c6fahD_3.13PDB header: flavoproteinChain: D: PDB Molecule: caffeyl-coa reductase-etf complex subunit carc;


Added to library: Sat Jan 27 08:42:58 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYFSEQNKMIRKLARDFAEKELTTEILDEVEESGEFPQEILDKMAKFGFFGIKIPKSLGGSGGDHMSYVI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



S
S



TTGGGSSS
GGGTS



 .........80.........90.........100.........110.........120.........130.........140
Sequence CMEEFARVSGVASVYLSSPNSLAGGPLLLSGTEEQIEKYLKPIITGKKKLAFALTEPGAGSDAGGMSTTA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TTT

TS




SS
SS
GGG


 .........150.........160.........170.........180.........190.........200.........210
Sequence VDMGDYYLLNGRKTFITMAPLCDDAVIYAKTDMSKGTRGISAFIVDLKSEGVSMGKNEHKMGLIGCATSD
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
SSTGGG
SSSTTTGGGSTTSSS






SS
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IIMEDVKVPKENRLGEVNKGFSNAMKTLDVGRLGVASQSIGVAQGALDEAIKYAKERKQFGKRIADFQAI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) GGGSSTT

TTGGGS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AFMIADMATKLEAAKLLVYNAASLMDNKKNATKEASMAKFYASEICNEICAKAVQIHGGYGYIKEYKVER
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TTS

GGGGGSTTS
 .........360.........370.........
Sequence MYRDCRVFTIYEGTSQVQQMVISGMLLKK
Predicted secondary structure







SS confidence




























Known secondary structure (DSSP) TTGGGTSSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D