Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fahB_

Fold library idPDB HeaderMoleculeTitle
c6fahB_3.13PDB header: flavoproteinChain: B: PDB Molecule: caffeyl-coa reductase-etf complex subunit card;


Added to library: Sat Jan 27 08:22:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRILVCAKQVPDTNEVKIDPKTGTMIREGVPSILNPDDANALEAALVIKDENPGTEVIVMTMGPPQASEM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



TTTTT


TT




SS


STT
S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LRECLAMGADEAYLLSDRAFGGADTWATSATLAAGIKKVKKVDLVLAGRQAIDGDTAQVGSQIAQRLKMP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T
S

TTTSS

TSS

SS

TTT



TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence VVTYVEDIKIEDKKAIVHRQMEDGYEVIEVQLPCLLTCVKELNDPRYMSVGGIMDAYEQPITIWNHEDIG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) B

STTTT

SS
GGG






S


TTTTT
 .........220.........230.........240.........250.........260..
Sequence LSPEACGLNASPTQVFRSFSPPAKGGGEMITGTTVNEVAGSLVSKLKEKHII
Predicted secondary structure






















SS confidence



















































Known secondary structure (DSSP)

SSSSTTSS
SS


















SSTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D