Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6fahB_

Fold library idPDB HeaderMoleculeTitle
c6fahB_3.13PDB header: flavoproteinChain: B: PDB Molecule: caffeyl-coa reductase-etf complex subunit card;


Added to library: Sat Jan 27 08:22:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRILVCAKQVPDTNEVKIDPKTGTMIREGVPSILNPDDANALEAALVIKDENPGTEVIVMTMGPPQASEM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



TTTTT


TT




SS


STT
S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LRECLAMGADEAYLLSDRAFGGADTWATSATLAAGIKKVKKVDLVLAGRQAIDGDTAQVGSQIAQRLKMP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T
S

TTTSS

TSS

SS

TTT



TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence VVTYVEDIKIEDKKAIVHRQMEDGYEVIEVQLPCLLTCVKELNDPRYMSVGGIMDAYEQPITIWNHEDIG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) B

STTTT

SS
GGG






S


TTTTT
 .........220.........230.........240.........250.........260..
Sequence LSPEACGLNASPTQVFRSFSPPAKGGGEMITGTTVNEVAGSLVSKLKEKHII
Predicted secondary structure






















SS confidence



















































Known secondary structure (DSSP)

SSSSTTSS
SS


















SSTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D