Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f74B_

Fold library idPDB HeaderMoleculeTitle
c6f74B_2.20PDB header: flavoproteinChain: B: PDB Molecule: alcohol oxidase;


Added to library: Sat Jan 13 08:28:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TPKCRCTPGEACWPDNSVWEAFDKTLGKGKLIKTSPIAQSCYDGPQKDLDRCAYVNKMWTDQDFQTSDPI
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SB
B
TTSTTS


TTS


TTGGGSSSTT

TT
STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GRNYPYNITCAPVDYAAGETPTSCILGSLPYYAVNASTREDITLTLNFAKQHNIRLVTSSTGHDLLGRSD
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

SS
SS
SB



TTTT




B

TTS
S

STTB
SSS

SSSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GYGGLELWLHSFRNGVRFQKKYTSANKCTKSGWTGSAIHIDGAYQWRDVYTVAQANNVIAVGGGSPSPGA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TT

TT
SS


TT


TT


S
S
BTT



SSSSSBS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IGGWPSGGGHGPATHNFGLGADQVLEAQIMLADGRIVTANHCENSDLFRAIRGGGPGYGIVLSQHIKVHP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SST



TT


TTS
TTBSTTS
S
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence NVKAVTAHRLAIAPRNETAENKDLLDAIAVLHQQLPALSNNGVAGYGFWFRSFPGPFVGDAHSGYTHGFW
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S
SS

SS
TTSS
SS
SBTTBS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TIGKRQAEAEKAVAPLMNALKKFEDKLVITSTFAEYQDYWSFYWAESGLHDPVGSTSIITSRLINPEALT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T

GGGTTTSS







S



GGGGS
 .........430.........440.........450.........460.........470.........480.........490
Sequence DYNKVREAIEVVAGKPEEVSSNVVLLVSGGQVFKDKADTSSGLHPAWRVSPFVMISGQGIPKVASREIRD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
T

TTS



STGGG
TT



GGGGT
S



SS

 .........500.........510.........520.........530.........540.........550.........560
Sequence YVQHQVTHVKGAALKKLAPNTGGYMNEGDGSDPEYIDAFYGKNYAQHLAAKRKYDPDNIFFCRTCVGAED
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TSTTSB

GGGS
TT
TTGGG
TT
TT

TTSTTGGG
 .........570..
Sequence FIERPDGPLCRK
Predicted secondary structure









SS confidence











Known secondary structure (DSSP)

SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D