Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f73B_

Fold library idPDB HeaderMoleculeTitle
c6f73B_2.22PDB header: flavoproteinChain: B: PDB Molecule: mtvao615;


Added to library: Sat Jan 13 08:28:58 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SCRVLPGDAAWPSSRDWAKLNKTLNGHLIATVPQASVCHKSPFGQYDAQACEELKSSWDISTITHVNAPG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
B


TTSTTS

TTT



GGGGG

TTT



TTTB

TSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DVLSQNFQNYSCVPFTDPSQPCQLGNYPSYVVNVTGAADVQAALKFAQKHNVRIVIKNTGHDYLGKSTGK
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S
TTSS
TTS
TTS



TTS
S

ST

SSS

TTSTT

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GALSLWMHNLKSTKFIKNYKAPYYKGPAAKLGAGVEGFEAYAMANSTGHRIVGGTCPTVGIVGGYTQGGG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T

TT


TTTT
BTT



SSTTSBTTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence HSILSSSYGVAADNVLEWEVVTADGRHLVATPTRNSDLYWALSGGGGGTFAVVLSMTARLHRDGIVGGTL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TT

GGGG
TT

BTTBSTTS
SSSS




 .........290.........300.........310.........320.........330.........340.........350
Sequence LGFNDSAVGNEVYWEAVAAFHALLPDFLDGGNSFTYSVGNNSLTAYGTMPGADRDAVDRLLRPFLDDLAS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) STTT
TT

SST

 .........360.........370.........380.........390.........400.........410.........420
Sequence RGITPVVQPRVSTNYYDHFFTYLGPAPYGNAAYFPFTNSRIIPRSLVTDPKSNAVVTDLFRNISQVPAFS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT


SSS
STTT


B

S

STSGGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence PFYCDSFSVADKPHPANSLHPAWRTGMLLCAPAGSWDWDASPEEMAARDRYAAETLQPMMDAATPGGSVY
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S


SS








T



TTS
TSTT
B

 .........500.........510.........520.........530.........540........
Sequence LNEANHLYANWKESFYGDNYARLLRVKKKYDPDSVFYVKTGVGSEVWDVDATGRLCRA
Predicted secondary structure


































SS confidence

























































Known secondary structure (DSSP) TTSS
TT
TTGGG
TT

B

TT
TTGGG
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D