Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f5dG_

Fold library idPDB HeaderMoleculeTitle
c6f5dG_3.20PDB header: hydrolaseChain: G: PDB Molecule: atp synthase gamma subunit;


Added to library: Sat Feb 24 08:36:19 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GKLRLYKEKLEGYNRFYSIVKTIKMVTLAKYRAAQGRIRTRDFSLRYTELAFSKPQAAKNALVYIPITTN
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TTTSS
SGGGS

S



S


B

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RGSCGALNSNIVRCIDSVVSSKMVLMPVGKRGIDSFSKLYPDEFRYGIINDMKESMHFGYATFVIENAYE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS


TT

SS


BS
TTTB


B



SS


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence VSKDADRYQVIFNRFVSAGVQRNAVYNIPSYEKWKEDLADAASSDNQKNRYLFANALQNEEEQLIRDFFD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TS


SSSSS

TSSSS
TTTS
 .........220.........230.........240.........250.........260.........270.......
Sequence FHAALAVLNAVGENELSEQAARLVAVEGQLTNISSLQQRTSSLYNKTRQFGITAALIEILSAMSSLE
Predicted secondary structure

SS confidence


































































Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D