Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f5dE_

Fold library idPDB HeaderMoleculeTitle
c6f5dE_3.20PDB header: hydrolaseChain: E: PDB Molecule: atp synthase subunit beta;


Added to library: Sat Feb 24 08:32:13 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VADHKGRVGHVSQVIGAVVDVHFADGVPPVLTALDVVDKLGRDEPLTLEIVQHLDAHTGRCIAMQTTDLL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

TTTT
TTTT



TT



SS
SS

SSSSSS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KLKAKVVSTGGNISVPVGRETLGRIFNVLGDAIDQRGPVGEKLRMPIHAVAPKLADQAAEDAVLTTGIKV
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)
TT

SSS

STTSTT

TT

B
S
S




S
SS




TTTB
SS

B


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence IDLILPYCKGGKIGLFGGAGVGKTVIIMELINNVAKGHGGFSVFAGVGERTREGTDLYLEMMQSKVIDLK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S

BTT


TTSST


T

TSS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GESKCVLVYGQMNEPPGARARVAQSALTMAEYFRDVEGQDVLLFIDNIFRFTQANSEVSALLGRIPAAVG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S




TTS
TS

TTSTT



GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence YQPTLAEDLGQLQERITSTTKGSITSVQAVYVPADDITDPAPATTFSHLDATTVLDRAVAESGIYPAVNP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TTTTSS
BSS




GGG
TTSTT
SB
T
SS
B
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence LECASRIMDPDVISVDHYNVAQDVVQMLTKYRELQDIIAVLGIDELSEEDKLIVDRARKLVKFLSQPFQV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
TT
STTTS
T
STTS
T



SS
 .........430.........440.........450.........460.........470.........480.......
Sequence AEVFTGMTGHYVQLDDTIDSFSGLLMGTYDQVPEMAFYMVGGINSVLEKAKKMAEEAAELEKMRRAR
Predicted secondary structure











SS confidence


































































Known secondary structure (DSSP) TSS





TTTSSS
STTTTT

STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D