Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f5dB_

Fold library idPDB HeaderMoleculeTitle
c6f5dB_3.20PDB header: hydrolaseChain: B: PDB Molecule: atp synthase alpha chain, mitochondrial;


Added to library: Sat Feb 24 08:33:17 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FKTTEMIGYVHSIDGTIATLIPAPGNPGVAYNTIIQIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




SS
TT




TT
SSSS


TTS

S
TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence SGQKVMATGQLLHIPVGAGVLGKVVNPLGHEVPVGLSTLGKVDTGAPNIVSRSPVNYNLLTGFKAVDTMI
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TT


SSTTTTS
SS







SS




TTTB



S

S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVISIYVSIGQRCSNVARIHRLLQSYGALR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT
B

TTSSS
GGG

S

TT
GG
 .........220.........230.........240.........250.........260.........270.........280
Sequence YTTVMAATAAEPAGLQYLAPYAGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQISLLLRRPPGREAYPGD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) G
SSS
TT
TTT

B
GGG
BTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQRPAVNI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
BB
GGGTT

SSS
TTSSS
S
SS
B
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GLSVSRVGSSAQNAAMKGVAGKLKGILAEYRKLAQQVQTIPMIRGARFVALFNQKQPSYFMNAIVSLYAC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT
TTS






T

SS


 .........430.........440.........450.........460.........470.........480.........490
Sequence LNGYLDDVKVQYVKFYEYLLVHRDLGIMYGTAKNKFFYMYVQELNYLIRFFTLNSPILHGELEEMLKQHT
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TSSSSS
STTTS
S



SS

SS
GGG
SSSTTT
 .........500.........510.........520....
Sequence HLFLQHYQSKMNAIKSEKDVKALKNLLYSCKRAV
Predicted secondary structure








SS confidence

































Known secondary structure (DSSP) TTGGGGTS

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D