Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f5dB_

Fold library idPDB HeaderMoleculeTitle
c6f5dB_3.20PDB header: hydrolaseChain: B: PDB Molecule: atp synthase alpha chain, mitochondrial;


Added to library: Sat Feb 24 08:33:17 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FKTTEMIGYVHSIDGTIATLIPAPGNPGVAYNTIIQIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQ
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




SS
TT




TT
SSSS


TTS

S
TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence SGQKVMATGQLLHIPVGAGVLGKVVNPLGHEVPVGLSTLGKVDTGAPNIVSRSPVNYNLLTGFKAVDTMI
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TT


SSTTTTS
SS







SS




TTTB



S

S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVISIYVSIGQRCSNVARIHRLLQSYGALR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT
B

TTSSS
GGG

S

TT
GG
 .........220.........230.........240.........250.........260.........270.........280
Sequence YTTVMAATAAEPAGLQYLAPYAGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQISLLLRRPPGREAYPGD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) G
SSS
TT
TTT

B
GGG
BTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQRPAVNI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
BB
GGGTT

SSS
TTSSS
S
SS
B
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GLSVSRVGSSAQNAAMKGVAGKLKGILAEYRKLAQQVQTIPMIRGARFVALFNQKQPSYFMNAIVSLYAC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT
TTS






T

SS


 .........430.........440.........450.........460.........470.........480.........490
Sequence LNGYLDDVKVQYVKFYEYLLVHRDLGIMYGTAKNKFFYMYVQELNYLIRFFTLNSPILHGELEEMLKQHT
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TSSSSS
STTTS
S



SS

SS
GGG
SSSTTT
 .........500.........510.........520....
Sequence HLFLQHYQSKMNAIKSEKDVKALKNLLYSCKRAV
Predicted secondary structure








SS confidence

































Known secondary structure (DSSP) TTGGGGTS

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D