Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f4aB_

Fold library idPDB HeaderMoleculeTitle
c6f4aB_3.55PDB header: hydrolaseChain: B: PDB Molecule: suv3 helicase;


Added to library: Sat Jan 20 10:47:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EFKKNLENALAHVYSTQIENSAPDQVEFRKVAWLRLKDMLYNQLLDKNLPAKINGYDPGLMETISPTQPQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTSS

TTTTTTTT


SSTTTS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence HIIPHLVKMNKIKYEQFQYLLSSYYDCILNQEIIPSMLFSNPAEWFPEARKIRRHIIMHVGPTNSGKTFR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

T




SSSS




GGGG
TS



SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLQKLKAADYYAGPLRLLAREVYEKFKHENVRCNLLTGEEVILTSGTIEMIPLNQNFDVVVLDEIQMMAD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


SSTT



SS
B

GGG

SS


S
SGGGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence LDRGWAWTNALLGAKAKEVHCCGEASTIPLIKKIVEMTGDKLTINEYERMGKLVVEEEALYHSLKKGDCV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTT


S
GGGT



SS

S



TT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VAFSKKAILDLKLEIEKKTELVIYGSLPPETRVKQANLFNSGEFDILIASDAIGMGLNLSIDRVVFTTSM
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S
S




TTS
TTT



GGGGSSS



S



 .........360.........370.........380.........390.........400.........410.........420
Sequence VDMTSSAIKQIGGRAGPVGYITAVKPNVLKAVREAINAPIEYLTSATTWPTDEICTHVMTTLLETIAADI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)



GGG


SSS











T
 .........430.........440.........450.........460.........470.........480.........490
Sequence EQNKLFQICDLKARMSAIEIITFSDKLRLSNAPLKDPLVKAAFKKFCDTIARGSYRPFDILLEEYEALYN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


S


TT


STTT





T









 .........500.........510.........520.........530....
Sequence IIMLFFWLSNRYPNFIDQESASELKNFCEMIIFEKIDHLKRNPY
Predicted secondary structure










SS confidence











































Known secondary structure (DSSP)





T






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D