Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f4aB_

Fold library idPDB HeaderMoleculeTitle
c6f4aB_3.55PDB header: hydrolaseChain: B: PDB Molecule: suv3 helicase;


Added to library: Sat Jan 20 10:47:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EFKKNLENALAHVYSTQIENSAPDQVEFRKVAWLRLKDMLYNQLLDKNLPAKINGYDPGLMETISPTQPQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTSS

TTTTTTTT


SSTTTS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence HIIPHLVKMNKIKYEQFQYLLSSYYDCILNQEIIPSMLFSNPAEWFPEARKIRRHIIMHVGPTNSGKTFR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

T




SSSS




GGGG
TS



SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLQKLKAADYYAGPLRLLAREVYEKFKHENVRCNLLTGEEVILTSGTIEMIPLNQNFDVVVLDEIQMMAD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


SSTT



SS
B

GGG

SS


S
SGGGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence LDRGWAWTNALLGAKAKEVHCCGEASTIPLIKKIVEMTGDKLTINEYERMGKLVVEEEALYHSLKKGDCV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTT


S
GGGT



SS

S



TT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VAFSKKAILDLKLEIEKKTELVIYGSLPPETRVKQANLFNSGEFDILIASDAIGMGLNLSIDRVVFTTSM
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S
S




TTS
TTT



GGGGSSS



S



 .........360.........370.........380.........390.........400.........410.........420
Sequence VDMTSSAIKQIGGRAGPVGYITAVKPNVLKAVREAINAPIEYLTSATTWPTDEICTHVMTTLLETIAADI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)



GGG


SSS











T
 .........430.........440.........450.........460.........470.........480.........490
Sequence EQNKLFQICDLKARMSAIEIITFSDKLRLSNAPLKDPLVKAAFKKFCDTIARGSYRPFDILLEEYEALYN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


S


TT


STTT





T









 .........500.........510.........520.........530....
Sequence IIMLFFWLSNRYPNFIDQESASELKNFCEMIIFEKIDHLKRNPY
Predicted secondary structure










SS confidence











































Known secondary structure (DSSP)





T






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D