Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f42V_

Fold library idPDB HeaderMoleculeTitle
c6f42V_5.50PDB header: transcriptionChain: V: PDB Molecule: transcription factor iiib 70 kda subunit;


Added to library: Sat Jan 20 10:50:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSELESREATLNNARRKLRAVSYALHIPEYITDA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


SSS

S


TTS


SSS


S





TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence AFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITEL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
SSSS
TT
S

STS
TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence PLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRTHTE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)



TT

S
TTSSS
SSS
TTTT




SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKECPRNLHLLPTTDTYLS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TSSSTTTTTT


S














STTS

ST
 .........290.........300.........310.........320.........330..
Sequence KVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQ
Predicted secondary structure














SS confidence



















































Known secondary structure (DSSP) TS


SS

TTS

STTTS
S

STTT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D