Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f42V_

Fold library idPDB HeaderMoleculeTitle
c6f42V_5.50PDB header: transcriptionChain: V: PDB Molecule: transcription factor iiib 70 kda subunit;


Added to library: Sat Jan 20 10:50:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSELESREATLNNARRKLRAVSYALHIPEYITDA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


SSS

S


TTS


SSS


S





TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence AFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITEL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
SSSS
TT
S

STS
TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence PLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRTHTE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)



TT

S
TTSSS
SSS
TTTT




SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKECPRNLHLLPTTDTYLS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TSSSTTTTTT


S














STTS

ST
 .........290.........300.........310.........320.........330..
Sequence KVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQ
Predicted secondary structure














SS confidence



















































Known secondary structure (DSSP) TS


SS

TTS

STTTS
S

STTT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D