Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f40P_

Fold library idPDB HeaderMoleculeTitle
c6f40P_3.70PDB header: transcriptionChain: P: PDB Molecule: dna-directed rna polymerase iii subunit rpc6;


Added to library: Sat Jan 20 10:21:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKNLIKLVKQNDELKFQGVLESEA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
S
S
S




SS
TT




TTS




STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QKKATMSAEEALVYSYIEASGREGIWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIYML
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TS

SS
TT


TT


SSS
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence YSLQPSVELDIEFINSLLTIVWRFISENTQEILEFITAAQVANVELTPSNIRSLCEVLVYDDKLEKVTHD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS






SSS
ST


STT


S


TTSTTT
 .........220.........230.........240......
Sequence CYRVTLESILQMIFNYFKMFPASKHDKEVVYFDEWT
Predicted secondary structure






























SS confidence



































Known secondary structure (DSSP)
S





SS




SS





SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D