Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f3hB_

Fold library idPDB HeaderMoleculeTitle
c6f3hB_2.70PDB header: hydrolaseChain: B: PDB Molecule: exoribonuclease ii, mitochondrial;


Added to library: Sat Jan 20 10:23:33 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HRGNXEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTXCVNLPQSTTDPRYTFAKKDGTLVYAXK
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TTSTTSB
T

S
TT
SSSTTS




SSS

TTS

G
 .........80.........90.........100.........110.........120.........130.........140
Sequence NSVILRIPKDLPEEVNQLLKRESNLPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) GG




TT


BTTB
 .........150.........160.........170.........180.........190.........200.........210
Sequence HVNFXSLVRIIKNLNIKEATDAYVRKVIDESXSVVNKSIDPTTLLATYWGVREQQQNNLWGSVYTNTALL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T




SS

B
TTTSTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYIRTLLNDYAAGNIEENA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TTTTTT

TTSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VLTTIISKIFRHIDXYRDQDVTRSLCGKLLVEISPQSNSSNFILGNWDLNIPKGISSVEQKLYDTAXPTI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TSTTTTTS


TS
S
S
S

GGG
TTTT









 .........360.........370.........380.........390.........400.........410.........420
Sequence VTDRYDFGDXPVFCIDSEDAHEINDGISIEELDGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




TT
B
B

B
TT





SSS

GGGSGGGT

SS
S


 .........430.........440.........450.........460.........470.........480.........490
Sequence KRAFTTYLPDLVVPXLPKSFCNRADLGKHDRKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
B

SS

SS

S

TT


TTS

B



 .........500.........510.........520.........530.........540.........550.........560
Sequence TYDKVDSILNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDCIPTFYDQS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) BTSTT


S






S
SS
S





 .........570.........580.........590.........600.........610.........620.........630
Sequence QTKSTLLVSEFXILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKENIKLGKLPSLKDITKIS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TT









TSTTS


 .........640.........650.........660.........670.........680.........690.........700
Sequence SQLSSSFYSPFPLPHKXIGNTAYLTVTSPXRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSFQARAD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT


SS


BTTT
SS




S
TTTBTT


SS
 .........710.........720.........730.........740.........750.........760.........770
Sequence ILKIFQRHSSTYWTLKHLEQSGTKTHDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAXKKIPRIGDTIR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT


S

SSS
TT
SS


TT
SS


TT
 .........780.........790
Sequence HCKVESIHPLDGILTLTHVN
Predicted secondary structure




SS confidence



















Known secondary structure (DSSP) GGGT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D