Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f3hB_

Fold library idPDB HeaderMoleculeTitle
c6f3hB_2.70PDB header: hydrolaseChain: B: PDB Molecule: exoribonuclease ii, mitochondrial;


Added to library: Sat Jan 20 10:23:33 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HRGNXEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTXCVNLPQSTTDPRYTFAKKDGTLVYAXK
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TTSTTSB
T

S
TT
SSSTTS




SSS

TTS

G
 .........80.........90.........100.........110.........120.........130.........140
Sequence NSVILRIPKDLPEEVNQLLKRESNLPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) GG




TT


BTTB
 .........150.........160.........170.........180.........190.........200.........210
Sequence HVNFXSLVRIIKNLNIKEATDAYVRKVIDESXSVVNKSIDPTTLLATYWGVREQQQNNLWGSVYTNTALL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T




SS

B
TTTSTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SPTTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYIRTLLNDYAAGNIEENA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TTTTTT

TTSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence VLTTIISKIFRHIDXYRDQDVTRSLCGKLLVEISPQSNSSNFILGNWDLNIPKGISSVEQKLYDTAXPTI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TSTTTTTS


TS
S
S
S

GGG
TTTT









 .........360.........370.........380.........390.........400.........410.........420
Sequence VTDRYDFGDXPVFCIDSEDAHEINDGISIEELDGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




TT
B
B

B
TT





SSS

GGGSGGGT

SS
S


 .........430.........440.........450.........460.........470.........480.........490
Sequence KRAFTTYLPDLVVPXLPKSFCNRADLGKHDRKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
B

SS

SS

S

TT


TTS

B



 .........500.........510.........520.........530.........540.........550.........560
Sequence TYDKVDSILNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDCIPTFYDQS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) BTSTT


S






S
SS
S





 .........570.........580.........590.........600.........610.........620.........630
Sequence QTKSTLLVSEFXILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKENIKLGKLPSLKDITKIS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TT









TSTTS


 .........640.........650.........660.........670.........680.........690.........700
Sequence SQLSSSFYSPFPLPHKXIGNTAYLTVTSPXRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSFQARAD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT


SS


BTTT
SS




S
TTTBTT


SS
 .........710.........720.........730.........740.........750.........760.........770
Sequence ILKIFQRHSSTYWTLKHLEQSGTKTHDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAXKKIPRIGDTIR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT


S

SSS
TT
SS


TT
SS


TT
 .........780.........790
Sequence HCKVESIHPLDGILTLTHVN
Predicted secondary structure




SS confidence



















Known secondary structure (DSSP) GGGT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D