Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f36N_

Fold library idPDB HeaderMoleculeTitle
c6f36N_3.70PDB header: proton transportChain: N: PDB Molecule: mitochondrial atp synthase subunit asa6;


Added to library: Sat Dec 23 08:26:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YSTQAKIALFGALSWILYRADGQSKAHEWIVDLNLNVLQAAWLISFSSLIPFRAVYFAFRGMAPATASTL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TTTTTSSTTTSSSSTTTS
SSSSTTTSS

 .........80.
Sequence NGLKTFSSISL
Predicted secondary structure



SS confidence










Known secondary structure (DSSP)
S

STT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D