Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f36M_

Fold library idPDB HeaderMoleculeTitle
c6f36M_3.70PDB header: proton transportChain: M: PDB Molecule: mitochondrial atp synthase subunit 6;


Added to library: Sat Dec 23 08:31:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVRDVKTGSLPTNFLTGVYRFWRSQNPAEKPHDPVNDRLLPAVVDASDKRASIGTWATTFFCTIISCNLL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)





TT
TTTS




SS


SSSTTSS

TTTTGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence GLMPFNEAPTSGLGFATGLGVSVWATATILGLSKTGFKFPGHFIPGGTPWPMAFIFVPLETISYTFRAVS
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) GTSTT


GGGSTTTTTTTTTSSSSS







STTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LGVRLWVNMLAGHTLLHILTGMALALPFSLGFFSMVPATFGVCCLLSALVGLEYLVAVLQSGVFSILSTV
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTS
TTTTTTT
 .........220........
Sequence YVGEFNHDKFIGPAAKIV
Predicted secondary structure
SS confidence

















Known secondary structure (DSSP) TT







S
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D