Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1yj_

Fold library idPDB HeaderMoleculeTitle
c6f1yj_3.40PDB header: motor proteinChain: J: PDB Molecule:


Added to library: Sat Jan 20 10:49:42 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSILSEVSTRARSKLPSGKNILVFGEDGSGKTTLMTKLQHGKKGRGLEYLYLSVHDEDRDDHTRCNVWIL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

TS








SSTT




SSS




SSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence DGDLYHKGLLKFAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVK
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
S
SSTTT

TTTSSS


SSSSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence DFQDYMEPEEGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTSSSTT







S

SS



TTT

ST




T
 .........220.........230.........240.........250.........260.........270.........280
Sequence KEEKNLDLLYKYIVHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) T

TT





B
SSSSS

TT


SSTTSSS
SS
SSTTTSSTTS

SS
 .........290.........300...
Sequence DKELAAEDEQVFLMKQQSLLAKQ
Predicted secondary structure










SS confidence






















Known secondary structure (DSSP)









STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D