Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1yf_

Fold library idPDB HeaderMoleculeTitle
c6f1yf_3.40PDB header: motor proteinChain: F: PDB Molecule:


Added to library: Sat Jan 20 08:42:57 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDD
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
T
SS



SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TTTTSTT
TT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RAWTQVLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) T

GGGGGSS

TT









S
S
TT
S
TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence EESYSAVMGIVSEVEQYVKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D