Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1uf_

Fold library idPDB HeaderMoleculeTitle
c6f1uf_3.40PDB header: motor proteinChain: F: PDB Molecule: arp1 actin related protein 1 homolog a;


Added to library: Sat Jan 20 10:38:55 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EIPEISLPIHPMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)









T
SS

SSSSGGGS

S



TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFP
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) STT
T
TTTTTSS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNDLLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TT

STTTTTTTT

TT
TTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) STTT









 .........290.........300.........310.........320.........330.........340.........350
Sequence VRVANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFR
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


TTTT
GGG
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence IFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQ
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SGGGG
TTTS
TTTSTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence IDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIEST
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTTTTTSSSS

TTTTTTTTTTTS


B
 .........500.........510.........520.........530.........540.........550.........560
Sequence RVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

B
STT
B


B
S
SST




TT
 .........570.........580.........590......
Sequence KVEERNTISLLVAGLKKEVQALIAEGIALVWESYKL
Predicted secondary structure













SS confidence



































Known secondary structure (DSSP) T
SS



SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D