Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1to_

Fold library idPDB HeaderMoleculeTitle
c6f1to_3.50PDB header: motor proteinChain: O: PDB Molecule: dynactin subunit 3;


Added to library: Sat Jan 20 11:54:06 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TSSSTTS











TTT
SS
B

B
SSSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SYNNNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TTSTTS
SS
SSS

SS
S


B
SS
S


BTTBTTTTS
SSS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSM
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S
S





TTS

S





SSS
SSS
SS

SS
S



SSSSS




 .........220.........230.........240.........250.........260.........270.........280
Sequence SFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

TTT
S


SSS


SSTT
SS






S
B




S
SSSS




BTTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence LWSTKNNKPLYSFEDNAGYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT
SS





SS




SSSTT

SSS
SSS
SSS
SS
SS




 .........360.........370.........380.........390.......
Sequence WTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINAN
Predicted secondary structure

















SS confidence














































Known secondary structure (DSSP)
TTSS

SBS


SS



S
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D