Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1tf_

Fold library idPDB HeaderMoleculeTitle
c6f1tf_3.50PDB header: motor proteinChain: F: PDB Molecule: arp1 actin related protein 1 homolog a;


Added to library: Sat Jan 20 10:39:48 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDKE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



B

SSSSS

S
T
TT



S



 .........80.........90.........100.........110.........120.........130.........140
Sequence FISYNINIDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S




TTSSSS
BSSS
GGGT
SS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence SKMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)



S










T
SS

SSSSGGGS

 .........220.........230.........240.........250.........260.........270.........280
Sequence QSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVS
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S



TTSS
STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence FDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAIS
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
TTTTTSS
TTT

STTTTTTTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence RDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPA
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TT
TTTS
STTT









 .........430.........440.........450.........460.........470.........480.........490
Sequence HRKLQARLDQMRKFRRQHEQLRAVIVRVANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERID
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)


TTTT
GGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence RVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYP
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
SS
SGGGG
TTTS
TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence QSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TSTT

TTTTTTSSSS

 .........640.........650.........660.........670.........680.........690.........700
Sequence FDDWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTTTTTTTTTTS


B


B
STT
B


B
S
SST




 .........710.........720.........730.........740.........750.........760.........770
Sequence HQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAE
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TTT
SS



SSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence TVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIE
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTTSTT
TT
SS
 .........850.........860.........870.........880.........890.........900.........910
Sequence RILGVRLQAGLRAWTQVLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)


GGGGGGGGGSS

TT









S
S
TT
S
TTTT
 .........920.........
Sequence ESYSAVMGIVSEVEQYVKV
Predicted secondary structure

SS confidence


















Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D