Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1sA_

Fold library idPDB HeaderMoleculeTitle
c6f1sA_2.40PDB header: hydrolaseChain: A: PDB Molecule: cgliir protein;


Added to library: Sat Feb 17 08:23:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LSGGVNYFAADPRIKNVEALDKKLLAYLDKHGEDSTIGXRAIITILNAFTVDPNDLDLATFKAALLDFER
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

TT

SS
SS
S
TT

TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence NQPHLTARXVLRTNRKVNQGTGALLSPTDQALSRAEVAHPLLILYRIEGVNDAAAQRGEPTWSSDPIWVP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TT




TTSS





SS

S
TT



SSSS
 ......
Sequence NIKLPG
Predicted secondary structure





SS confidence





Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D