Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1cC_

Fold library idPDB HeaderMoleculeTitle
c6f1cC_4.20PDB header: hydrolaseChain: C: PDB Molecule: complement c1r subcomponent;


Added to library: Sat Jan 20 10:47:41 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S
S
TTTTS


SS

TTB



TTS
S
SSSBS
 .........80.........90.........100.........110.........120.........130.........140
Sequence QLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQ
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) BSS
SSSB

TT




SSS
S
SSSSSS







SSS


S

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence CQHLCHNYVGGYFCSCRPGYELQEDTHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SS
SS


TT
TTSS


SS
SSS
SSSSS


SS


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S

B



SSSSSSS
TT
SSS






S

S


S
B
 .......
Sequence RYTTEII
Predicted secondary structure
SS confidence






Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D