Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f1cC_

Fold library idPDB HeaderMoleculeTitle
c6f1cC_4.20PDB header: hydrolaseChain: C: PDB Molecule: complement c1r subcomponent;


Added to library: Sat Jan 20 10:47:41 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S
S
TTTTS


SS

TTB



TTS
S
SSSBS
 .........80.........90.........100.........110.........120.........130.........140
Sequence QLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQ
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) BSS
SSSB

TT




SSS
S
SSSSSS







SSS


S

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence CQHLCHNYVGGYFCSCRPGYELQEDTHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SS
SS


TT
TTSS


SS
SSS
SSSSS


SS


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S

B



SSSSSSS
TT
SSS






S

S


S
B
 .......
Sequence RYTTEII
Predicted secondary structure
SS confidence






Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D