Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eznG_

Fold library idPDB HeaderMoleculeTitle
c6eznG_3.30PDB header: membrane proteinChain: G: PDB Molecule: dolichyl-diphosphooligosaccharide--protein


Added to library: Sat Jan 20 09:53:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RTLVLYDQSTEPLEEYSVYLKDLEQRNYKLEYLDINSTSTTVDLYDKEQRLFDNIIVFPTKGGKNLARQI
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTTB
SGGGTT



TT

S


SBSSSSB

S




SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PVKQLIKFFENEGNILCMSSPGAVPNTIRLFLNELGIYPSPKGHVIRDYFSPSSEELVVSSNHLLNKYVY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTS

BTTB

TT

SS

S
SSSSSGGGB

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NARKSEDFVFGESSAALLENREQIVPILNAPRTSFTESKGKCNSWTSGSQGFLVVGFQNLNNARLVWIGS
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SS

SSB




SS
B


SS
SSS


S

TTT
BS
TTS

B
 .........220.........230.........240.........250.........260.........270.........280
Sequence SDFLKNKNQDSNQEFAKELLKWTFNEKSVIKSVHAVHSHADGTSYDEEPYKIKDKVIYSVGFSEWNGEEW
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTTSSTT

SSSSTTTSS



TTS

TTTS

BSS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LPHIADDIQFELRQVDPYYRLTLSPSGNDSETQYYTTGEFILPDRHGVFTFLTDYRKIGLSFTTDKDVKA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


S

SSS
B




SS





SS


TTS

 .........360.........370.........380.........390....
Sequence IRHLANDEYPRSWEISNSWVYISAICGVIVAWIFFVVSFVTTSS
Predicted secondary structure
















SS confidence











































Known secondary structure (DSSP) B


SSSS

TTTSSSTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D