Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eznG_

Fold library idPDB HeaderMoleculeTitle
c6eznG_3.30PDB header: membrane proteinChain: G: PDB Molecule: dolichyl-diphosphooligosaccharide--protein


Added to library: Sat Jan 20 09:53:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RTLVLYDQSTEPLEEYSVYLKDLEQRNYKLEYLDINSTSTTVDLYDKEQRLFDNIIVFPTKGGKNLARQI
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTTB
SGGGTT



TT

S


SBSSSSB

S




SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PVKQLIKFFENEGNILCMSSPGAVPNTIRLFLNELGIYPSPKGHVIRDYFSPSSEELVVSSNHLLNKYVY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTS

BTTB

TT

SS

S
SSSSSGGGB

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NARKSEDFVFGESSAALLENREQIVPILNAPRTSFTESKGKCNSWTSGSQGFLVVGFQNLNNARLVWIGS
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

SS

SSB




SS
B


SS
SSS


S

TTT
BS
TTS

B
 .........220.........230.........240.........250.........260.........270.........280
Sequence SDFLKNKNQDSNQEFAKELLKWTFNEKSVIKSVHAVHSHADGTSYDEEPYKIKDKVIYSVGFSEWNGEEW
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTTSSTT

SSSSTTTSS



TTS

TTTS

BSS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LPHIADDIQFELRQVDPYYRLTLSPSGNDSETQYYTTGEFILPDRHGVFTFLTDYRKIGLSFTTDKDVKA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


S

SSS
B




SS





SS


TTS

 .........360.........370.........380.........390....
Sequence IRHLANDEYPRSWEISNSWVYISAICGVIVAWIFFVVSFVTTSS
Predicted secondary structure
















SS confidence











































Known secondary structure (DSSP) B


SSSS

TTTSSSTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D